Information

Vad heter de kolonavgränsade fälten i denna FASTA-rubrik?

Vad heter de kolonavgränsade fälten i denna FASTA-rubrik?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

De mänskliga kromosomernas DNA-data i Ensembl release 96, här är i FASTA-format.

När jag läser Wikipedia-artikeln om FASTA-formatet förstår jag den första raden med prefixet>, hänvisas till på olika sätt som en "kommentar" eller "sekvensrubriker". Men om man tittar på FASTA-filer från olika källor verkar det som om den här första raden är ganska varierande i det faktiska innehållet.

Vilka är de kolonseparerade fälten i denna FASTA-rubrik (som finns ovan på Ensembles FTP-webbplats)? De flesta fält går att gissa, men en förklaring av varje fält skulle vara mycket uppskattat. Jag tror att46709983är antalet baspar i kromosomen.

>21 dna:kromosomkromosom:GRCh38:21:1:46709983:1 REF

Slutligen, hur skulle jag ha listat ut innebörden av rubriknotationen för mig själv? Finns det en lista över vanliga eller kända rubrikformat?


Enligt ensembls hemsida (om än något begravd i en sida om nedladdning av data via FTP) står det:

"Rubrikraden i en FASTA-dumpfiler som innehåller DNA-sekvens består av följande attribut: coord_system:version:name:start:end:sträng Denna koordinatsystemsträng används i Ensembl API för att hämta skivor med SliceAdaptor."

En kort sammanfattning av dessa attribut som jag förstår dem:

  • coord_system- Är helt enkelt koordinatsystemet som används för att lokalisera en viss funktion i en sammansättning: "kromosom" och "BAC-klon" är vanliga exempel som beskrivs här.
  • version- Detta är den aktuella versionen av monteringsreferensen. Och hänvisar till ett Ensembl-arkiv som beskrivs här. (Din verkar vara från den mänskliga GRch38-församlingen).
  • namn- Detta verkar ganska självförklarande. I det här fallet tittar vi på kromosom 21.
  • start- igen, självförklarande. Varje komplett kromosom eller sammanhängande sekvens kommer att börja vid "1".
  • slut- Slutet av fasta-sekvensen. [start] - [slut] + 1 = total längd
  • sträng- Detta hänvisar till orientering (dvs. framåt eller bakåt sträng) 1 är framåt (-1 är bakåt)

Här är en länk till en pdf som innehåller denna information och mer om hur man använder Ensembl (se sidan 23)...

Tyvärr, för att besvara din sista fråga, finns det inget enkelt sätt att komma över denna information och det finns lika många sätt att märka fasta-filer som det finns sekvensdatabaser. Sekvensförråd har kommit långt under de senaste 10 åren men det finns fortfarande mycket arbete att göra för att standardisera dataformat och göra databaser mer användarvänliga.


Jag vill ersätta ett sekvensnamn i fasta-filen med ett annat namn

Jag har en fasta-fil och en textfil fasta-filen innehåller sekvenser i fasta-format och textfilen innehåller namn på gener nu vill jag ersätta namnet på sekvenserna i fasta-filen efter '>'-tecken med gennamnen i textfilen Jag är ny to perl även om jag har skrivit ett manus men jag vet inte varför det inte fungerar kan någon hjälpa mig med det, snälla följande är mitt manus:

mina filer ser ut så här:

pool75_contig_389 ubiquitin ligase e3a
pool75_contig_704 tumörkänslighet
pool75_contig_1977 serin treonin-protein fosfatas 4 katalytisk subenhet
pool75_contig_3064 bardet-biedl syndrom 2 protein P
pool75_contig_2499 succinyl-ligas


Bakgrund på FASTA-formatet

FASTA-formatet för sekvensdatabaser utvecklades ursprungligen av Pearson för användning med FASTA-programmet. Idag är det förmodligen det mest använda standardformatet, främst för att dess korthet resulterar i minsta möjliga filstorlek för sekvenser.

Ett exempel på formatet visas nedan:

>sp|P28190|AA1R_BOVIN ADENOSINE A1 RECEPTOR.
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAMAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLSKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDAPAERPDD

Standardformatet är inte särskilt specifikt eftersom det bara säger att det finns en enda rubrikrad per post som måste börja med tecknet ">" och alla efterföljande rader för en post innehåller en sekvens. Det finns dock många "standarder" beträffande arrangemang av fält och/eller avgränsning av fält i rubrikraden. Ofta används rubrikraden för att beskriva grundläggande information som postens namn, åtkomstnummer (eller annan unik identifierare) och arten eller organismen från vilken sekvensen erhölls.

FASTA-formatet valdes för användning med Spectrum Mill främst på grund av dess universalitet, korthet och förväntade lätthet med vilken sekvensdatabasfiler kunde delas på samma dator med andra program för sekvensanalys.


3 svar 3

9k poster av Pseudomonas-arter, dvs hundratals P.-arter. Kommandot ovan frågar efter namnet på varje Pseudomonas-post, korrekt ("Pseudomonas", "X")? Finns det något sätt att hämta Pseudomonas-posterna utan att ange alla Pseudomonas-namn (jag har inget listnamn)? Tack. $endgroup$ &ndash Fabricio 17 februari kl. 19:47

Du kan göra detta med seqkit enligt följande:

För att förklara lite så låter seqkit grep dig söka i FASTA/Q-filer efter sekvensnamn eller sekvens själv. I det här fallet:

  • -r berättar att mönstret är ett reguljärt uttryck
  • -n att matcha med fullständigt namn istället för bara id
  • -p för att ange det reguljära uttrycksmönster som ska sökas

Det finns ett gäng andra verktyg som följer med seqkit som kan visa sig oumbärliga för grundläggande sekvensanalyser.

"beskriver hela frågan".

Jag har en databas (silva 16S formaterad av DADA2 - fasta format) som innehåller

300 000 poster för bakterier (16S rRNA-gen). t.ex.,

AB001441.1.1538 Pseudomonas syringae pv. broussonetiae AACTGAAGAGTTTGATCATGGCTCAGATTGAACGCTGGCGGCAGG. KR054096.1.1224 Marinococcus halophilus GAAGGTAAAGGCTTCCCCAAGGGCGACGATGGGTAGCCGACTTGA. AB681405.1.1478 Paenibacillus barengoltzii GACGAACGCTGGCGGCGTGCCTAATACATGCAAGTCGAGCGGAGT. .

Jag skulle vilja hämta sekvenser för något släkte, t.ex. Pseudomonas. Efter att ha kört kommandot seqkit (som nämns av dig ovan) slutade jag med

9 av Pseudomonas-poster i en fasta-fil (exempel nedan).

AB001441.1.1538 Pseudomonas syringae pv. broussonetiae AACTGAAGAGTTTGATCATGGCTCAGATTGAACGCTGGCGGCAGGCCTAACA. AB001442.1.1538 Pseudomonas amygdali pv. eriobotryae AACTGAAGAGTTTGATCATGGCTCAGATTGAACGCTGGCGGCAGGCCTAACA. .


SAM-format

Detta är det mest grundläggande, mänskliga läsbara formatet av de tre. Detta genereras av nästan alla anpassningsalgoritmer som finns. Den består av en rubrik, en rad för varje läsning i din datauppsättning och 11 tabbavgränsade fält som beskriver den läsningen.

SAM Header

Rubriken varierar i storlek men följer ett visst format beroende på vilken information du bestämmer dig för att lägga till. Några exempel på information som kan matas in i rubriken är: kommando som genererade SAM-filen, SAM-formatversion, sequencernamn och version. Den fullständiga listan över tillgängliga rubrikfält finns nedan.

http://samtools.github.io/hts-specs/SAMv1.pdf http://samtools.github.io/hts-specs/SAMv1.pdf

Fältbeskrivningar

Varje rad innehåller 11 obligatoriska fält. Beskrivningarna för dem finns nedan:

http://samtools.github.io/hts-specs/SAMv1.pdf

Låt oss titta på några av fälten som inte är särskilt självförklarande:

Bitwise Flagga

Den bitvisa flaggan är en uppslagskod för att förklara vissa funktioner om den specifika läsningen (exakt samma koncept som Linux-behörighetskoder!). Den talar om för dig om den läsjusterade, är märkt som en PCR-duplicering, om den är parallelljusterad, etc. och vilken kombination av de tillgängliga taggar som helst, se nedan:

http://samtools.github.io/hts-specs/SAMv1.pdf

En viktig sak att notera är att varje kombination av dessa flaggor resulterar i ett heltal, vilket gör det lite svårt att tolka. För att göra det enkelt kan du kolla här för att antingen koda eller avkoda en bitvis flagga.

MapQ (Mapping Quality)

Detta värde rapporterar hur väl läsningen är anpassad till referensen. Olika algoritmer rapporterar det olika men inte desto mindre, ju större siffra desto bättre anpassning (i allmänhet).

CIGARR sträng

Detta är ett förkortat sätt att koda en hel justering. Istället för att skriva ut hela justeringen har operatorer definierats och används i kombination med siffror för att förklara vilken del av sekvensen som ställer in, vilken inte, och allt däremellan. Definitionen för operatörerna finns här:

https://www.drive5.com/usearch/manual/cigar.html https://genome.sph.umich.edu/wiki/SAM#What_is_a_CIGAR.3F


2 svar 2

Du kan göra det med bash quiet lätt. Skapa först en säkerhetskopia av din fasta-fil med

Med IFS=" " deklarerar du ett blanksteg som fältseparator och genom att läsa varje rad i din OTU_ID.txt har du de två variablerna otu och fastaId som innehåller otu-namnet och id för Fasta Header.

Inom while-loopen letar sed varje loop efter motsvarande id i ett RegEx och ersätter det med motsvarande otu-namn. Genom att använda alternativet -i skriver du över den befintliga filen. Det är därför du måste skapa en säkerhetskopia.

Du kan lägga fasta-filen på en enda rad per sekvens:

Den här raden skapar nästa utdata:

Sedan kan du med awk matcha kolumner separerade med tab:

Du kan lägga till $1 för att kontrollera om du får rätt id.

Om allt är okej kan du omdirigera till en ny fil:

Hur det fungerar, ja awk går implicit genom varje fil, en rad i taget.

NR är antalet rader som awk har läst hittills och FNR är antalet rader som awk har läst från den aktuella filen. Således, om FNR==NR , läser vi fortfarande den förstnämnda filen: otu_id.txt. För varje rad i file.tsv tilldelar vi en[$2]=$1 .

Här är a en associativ array, och a[$2]=$1 betyder att spara file.tsv första kolumnen, betecknad $1 , som ett värde i array a med file.tsv andra kolumn, $2 , som nyckel.

next säger åt awk att hoppa över resten av kommandona och börja om med nästa rad.


Innehåll

En sekvens i FASTA-format börjar med en enkelradsbeskrivning, följt av rader med sekvensdata. Beskrivningsraden särskiljs från sekvensdata genom en symbol som är större än (">") i den första kolumnen. Ordet efter symbolen ">" är sekvensens identifierare, och resten av raden är beskrivningen (båda är valfria). Det ska inte finnas något mellanslag mellan ">" och den första bokstaven i identifieraren. Det rekommenderas att alla textrader är kortare än 80 tecken. Sekvensen slutar om en annan rad som börjar med ">" visas, vilket indikerar början på en annan sekvens. Ett enkelt exempel på en sekvens i FASTA-format:


7.8. Efterbehandling¶

7.8.1. Förstå utdatafilerna (.vcf)¶

Låt oss titta på varianterna:

Fälten i en vcf-fil beskrivs i tabellen (Tabell 7.1) nedan:

Tabell 7.1 Fälten för vcf-filformat. ¶

1-baserad position. För en indel är detta positionen före indel.

Variantidentifierare. Vanligtvis dbSNP rsID.

Referenssekvens vid POS involverad i varianten. För en SNP är det en enda bas.

Kommaavgränsad lista med alternativa sekvens(er).

Phred-skalad sannolikhet för att alla prover är homozygota referenser.

Semikolonavgränsad lista över filter som varianten inte klarar av.

Semikolonavgränsad lista med variantinformation.

Kolonavgränsad lista över formatet för individuella genotyper i följande fält.

Individuell genotypinformation definierad av FORMAT.

7.8.2. Statistik¶

Nu kan vi använda den för att göra lite statistik och filtrera våra variantanrop.

Först, för att förbereda vcf-filen för sökning måste vi indexera den med tabix:

Vi kan få lite snabb statistik med rtg vcfstats:

Exempel på utdata från rtg vcfstats:

Men vi kan också köra BCFtools för att extrahera mer detaljerad statistik om våra variantanrop:

-s - : lista över prover för provstatistik, "-" för att inkludera alla prover

-F FIL: faidx indexerad referenssekvensfil för att bestämma INDEL-kontext

Nu tar vi statistiken och gör några plotter (t.ex. Fig. 7.2) som är särskilt intressanta om man har flera sampel, eftersom man enkelt kan jämföra dem. Men vi arbetar bara med en här:

-p : Utdatafilens prefix, lägg till ett snedstreck i slutet för att skapa en ny katalog.

Fig. 7.2 Exempel på plot-vcfstats-utgång. ¶

7.8.3. Variant filtrering¶

Variantfiltrering är ett stort ämne i sig [OLSEN2015] . Det finns inga samförstånd ännu och forskning om hur man bäst filtrerar varianter pågår.

Vi kommer att göra några enkla filtreringsprocedurer här. För det första kan vi filtrera bort läsningar av låg kvalitet.

Här inkluderar vi endast varianter som har kvalitet > 30.

-q FLOAT: minimal tillåten kvalitet i utdata.

-f "QUAL >= 30" : vi inkluderar endast varianter som har anropats med kvalitet >= 30.

Snabbstatistik för de filtrerade varianterna:

freebayes lägger till lite extra information till vcf-filerna som den skapar. Detta möjliggör lite mer detaljerad filtrering. Denna strategi kommer INTE att fungera på SAMtools mpileup som kallas varianter Här filtrerar vi, baserat på någon rekommendation från utvecklaren av freebayes:

QUAL > 1 : tar bort riktigt dåliga webbplatser

QUAL / AO > 10 : ytterligare bidrag för varje obs bör vara 10 logenheter (

SAF > 0 & SAR > 0: läses på båda strängarna

RPR > 1 & RPL > 1: minst två läsningar "balanserade" på varje sida av webbplatsen

Titta på statistiken. Ett förhållande som nämns i statistiken är transition transversion ratio (ts/tv). Förklara vad detta förhållande är och varför det observerade förhållandet är vettigt.

Denna strategi som används här kommer att fungera för våra syften. Flera mer utarbetade filtreringsstrategier har dock utforskats, t.ex. här.

Nielsen R, Paul JS, Albrechtsen A, Song YS. Genotyp och SNP-anrop från nästa generations sekvenseringsdata. Nat Rev Genetics, 2011, 12:433-451

Olsen ND et al. Bästa praxis för att utvärdera anropsmetoder för enkel nukleotidvariant för mikrobiell genomik. Främre. Genet., 2015, 6:235.


Parsar en semikolonavgränsad fil i python för att skapa en CSV

Jag har en stor textfil i formatet nedan, som jag vill konvertera till en CSV-fil. Kolumnnamnen på CSV-filen bör motsvara den första delen av tuplarna som visas nedan. Det är säkert att anta att det första objektet i raden, som inte är en tuppel, alltid kommer att vara i formatet nedan.

Andra problem inkluderar att varje rad kanske inte har samma fält - vissa har till exempel status, andra inte. Vissa har flera instanser av samma fält, i vilket fall jag kräver att den andra delen av tuplarna sammanfogas (t.ex. Till Mr Smith Mrs Green), men det här är frågor som är längre bort för tillfället.

Min plan är att iterera genom varje block i filen för att fastställa kolumnnamnen, och sedan börja lägga till data till dessa kolumnnamn och lämna tomrum när så är lämpligt. Jag undrar bara hur jag ska gå tillväga på ett pytoniskt sätt, eftersom jag har lekt runt med en lista med ordböcker och fastnat.

Jag tror att jag måste dela raden och sedan lägga till varje tupel i en ordbok. Någon hjälp? Tack!


2 svar 2

Om både ID-raderna och sekvenserna är duplicerade kan du göra detta med FastaToTbl- och TblToFasta-skripten som jag har postat tidigare och bara vanliga Linux-verktyg:

För att förstå detta, låt oss titta på resultatet av varje steg. FastaToTbl-skriptet konverterar bara fasta till ett tabbavgränsat format där ID är det första fältet och sekvensen är det andra, allt på en rad:

Sedan skickar vi detta genom sort och uniq -dc som skriver ut antalet gånger en rad upprepades (endast för duplicerade rader):

Eftersom vi bara vill ha de som fanns i alla 6 filer, kan vi använda awk för att bara skriva ut rader vars första fält var 6:

Men då vill vi inte ha 6:an som en del av slutresultatet, så vi måste ta bort det:

Slutligen, konvertera till fasta igen:

Alternativt, om dina filer är tillräckligt små för att laddas in i minnet, kan du göra detta istället:


Titta på videon: CHIKKA AL VISSA. ALEX u0026 RUS. Car Race Music (Juli 2022).


Kommentarer:

  1. Caden

    Det kan sägas, detta undantag :) regler

  2. Ufa

    Underbar, bra idé

  3. Asliraf

    det händer inte mer exakt

  4. Keon

    Ja verkligen. Och jag stötte på det här. Vi kan kommunicera om detta tema. Här eller på PM.

  5. Turr

    Så det händer bara inte



Skriv ett meddelande