Information

Läser ribosomer mRNA?

Läser ribosomer mRNA?



We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Så jag förstår att tRNA binder till ett kodon (med ett antikodon) i translationsprocessen. Jag läste i min biologilärobok att ribosomerna "läser" mRNA-strängen.

Varför behöver ribosomerna läsa av mRNA-strängen? Kan ribosomerna tolka budskapet och föra det korrekta antikodonet till det? Eller är ribosomernas huvudsakliga funktion bara att sammanfoga aminosyror för att göra polypeptider? Jag är bara förvirrad varför ribosomerna läser mRNA-strängen när det verkar som om det inte finns något behov av det.


De två första meningarna i Wikipedia Ribosome-artikeln säger:

Ribosomen... fungerar som platsen för biologisk proteinsyntes (översättning). Ribosomer länkar samman aminosyror i den ordning som anges av messenger RNA (mRNA) molekyler.

Lite senare, i avsnittet Översikt står det:

Ribosomer kan binda till en budbärar-RNA-kedja och använda dess sekvens för att bestämma den korrekta sekvensen av aminosyror för att generera ett givet protein. Aminosyror selekteras, samlas in och transporteras till ribosomen av överförings-RNA (tRNA)-molekyler, som kommer in i en del av ribosomen och binder till budbärar-RNA-kedjan. Det är under denna bindning som den korrekta translationen av nukleinsyrasekvens till aminosyrasekvens sker.

Och det säger sedan till oss "De bifogade aminosyrorna länkas sedan samman av en annan del av ribosomen."

Så ribosomens funktion är att se till att varje kodon i mRNA:t matchas med rätt tRNA, och sedan katalysera kopplingen av den associerade aminosyran till den växande kedjan av proteinet som byggs.


Ribosomala fotspår på ett transkriptomlandskap

Nästa generations massivt parallell sekvenseringsteknologi ger ett kraftfullt nytt sätt att bedöma hastigheter och reglering av översättning över ett helt transkriptom.

Införandet av massivt parallella DNA-sekvenseringsplattformar under de senaste fem åren - så kallad "nästa generations" sekvenseringsteknologi - har skapat kapaciteten att generera tiotals miljoner korta sekvensläsningar i en enda körning. Dessa sekvenser kan identifieras genom anpassning till de kända genomen för de allra viktigaste modellorganismerna, inklusive Homo sapiens [1]. Informationen som samlas in från denna teknologi ger nya insikter om viktiga områden inom genom, kromatin och transkriptombiologi.

En av tillämpningarna av nästa generations sekvensering - kortläst cDNA-analys eller 'RNAseq' [2, 3] - har sina konceptuella rötter i seriell analys av genuttryck (SAGE) [4]. Medan SAGE tillhandahåller tusentals sekvenser av kortsekvenstaggar som har klonats som konkatemerer, ökar RNAseq ante till tiotals miljoner oberoende härledda sekvenser per experiment. För RNA-biologi ger transkriptomanalys av RNAseq robust kvantitativ reproducerbarhet, dynamiskt omfång av många storleksordningar, transkriptionsriktning, analys av repetitiva sekvenser, oberoende mätning av mycket lika sekvenser och detektion av post-transkriptionell bearbetning på enstaka nukleotidnivå. Med hjälp av RNAseq-metodologi, en färsk studie från Jonathan Weissmans laboratorium (Ingolia et al. [5]) gav en ögonblicksbild av den linjära distributionen av ribosomer i stabilt tillstånd på RNA-transkript i celler av Saccharomyces cerevisiae, tillhandahåller ett nytt kraftfullt experimentellt verktyg för analys av translationell kontroll och samtranslationsprocesser.


Vad gör en ribosom?

På molekylär nivå fungerar ribosomen som en dekrypteringsmaskin. DNA transkriberar till budbärar-RNA (mRNA), som exporteras från kärnan till cytoplasman. mRNA-molekylen är som genetiska koder skrivna på en lång papperstråd. Ribosomen hittar den högra änden av mRNA-tråden och börjar läsa koderna. Ribosomen använder kodsekvensen för att bestämma den korrekta ordningen av aminosyror för att generera motsvarande protein. Under processen sitter den stora underenheten ovanpå den lilla underenheten, med en RNA-mall inklämd mellan de två. (En ribosom ser ut som en hamburgare med en pösig bulle på toppen, en RNA-"patty" tränger igenom den.)

[I denna figur] En analogi för ribosomer i en fabrik.
Ribosomer fungerar som maskiner för att översätta kodsekvensen för mRNA till ett protein. Forskare gillar att kalla ribosomer, de molekylära mikromaskinerna, för att beundra hur utsökt ribosomernas design är!


Hur förhåller sig ribosomer till DNA?

Olika former av RNA har olika funktioner. Messenger-RNA (mRNA) transkriberar ett segment av DNA under den första delen av proteinsyntesen som kallas transkription. Kvävebaserna i mRNA:t är komplementära till kvävebaserna i DNA-segmentet. Var tredje bas bildar ett kodon, som kodar för en specifik aminosyra.

mRNA:t färdas till en ribosom, antingen i cytoplasman eller på det grova endoplasmatiska retikulumet. Ribosomer, som tillverkas i kärnan, är sammansatta av ribosomalt RNA (rRNA) och proteiner. De är platsen för translation, processen där mRNA-koden översätts till en sekvens av aminosyror.

Aminosyrorna transporteras från cytoplasman till mRNA vid ribosomen av överförings-RNA (tRNA)-molekyler. tRNA:t innehåller ett antikodon som består av tre kvävebaser och parar sig med mRNA:t, kodon till antikodon.

tRNA-antikodonet är detsamma som det ursprungliga DNA-kodonet, förutom att tRNA innehåller kvävebasen uracil snarare än tymin som finns i DNA. På så sätt återställs den ursprungliga DNA-koden, och aminosyrorna placeras i rätt ordning på ribosomen.


PKR och ribosomen tävlar om mRNA

Det RNA-aktiverade proteinkinaset PKR hämmar translationsinitiering genom att känna av långt viralt dubbelsträngat RNA. En ny rapport indikerar att PKR också aktiveras av ett cellulärt mRNA, men bara när ribosomer inte initierar translation.

Reglering av genuttryck är nödvändig för att kontrollera protein-, RNA- och metabolitnivåer. Under de senaste decennierna har det blivit tydligt att RNA-veckning ger ett idealiskt medium för att kontrollera genuttryck, vilket kan tillskrivas dess förmåga att befolka flera ömsesidigt exklusiva stabila veck. Yanofskys och medarbetares banbrytande arbete avslöjade att konkurrerande RNA-basparning är ansvarig för att kontrollera åtkomsten av transkriptions- och translationsmaskineriet till viktiga initierings- och termineringssekvenser, vilket leder till transkriptionsdämpning och translationskontroll 1,2 i dessa fall, metabolitavkänning var utförs vanligtvis av metabolitbindande proteiner. På senare tid har Breaker, Henkin och Nudler och medarbetare visat att RNA-strukturbyten även kan ske i frånvaro av proteiner, där metaboliter binder direkt till RNA:t, i så kallade riboswitches 3,4,5. I den aktuella studien 6, Cohen-Chalamish et al. beskriver alternativa veck av 5'-änden av interferon-y (IFN-y) mRNA, av vilka en underlättar translationsinitiering genom interaktion med ribosomen och en av vilka hämmar translationsinitiering genom aktivering av proteinkinaset PKR.


Hur mycket vet vi om mRNA-vaccin?

Hur mycket studier har det gjorts kring mRNA-vacciner? Hur mycket oro ska vi ha runt dem?

Bara för att notera, jag är inte på något sätt anti-vax, jag oroar mig bara för det nya tillvägagångssättet att få mänskliga celler att generera proteiner via DNA-manipulation. Snälla säg att jag bara är paranoid :) (det här kommer från någon som har varit på olika biologiska läkemedel som Remicade, Humira och Entyvio)

2

mRNA-vacciner har funnits i decennier, den första rapporten om deras användning var 1993 (induktion av virusspecifika cytotoxiska T-lymfocyter in vivo av liposom-infångat mRNA). De har inte använts i stor utsträckning eftersom deras fördelar (snabb anpassningsbar utveckling) uppvägdes av deras nackdelar (svårigheter vid tillverkning och distribution). Uppenbarligen, inför en snabbrörlig pandemi, gör deras fördel i snabb utveckling dem mycket attraktiva och tillverknings- och distributionsproblemen kan hanteras.

Där mRNA-vaccin har använts är för att behandla cancer. Det behöver mycket anpassningsbar, individualiserad, småskalig utveckling och måste vara säker för användning i medicinskt ömtåliga människor - perfekt lämpad för tekniken. Exempel från 2009: Direktinjektion av protaminskyddat mRNA: Resultat av en Fas 1/2-vaccinationsförsök hos patienter med metastaserande melanom.

Denna typ av användning innebär att det faktiskt finns en rimlig mängd rimligt långtidsstudier i deras användning. Här är en recension från 2012:

mRNA-vacciner kombinerar önskvärda immunologiska egenskaper med en enastående säkerhetsprofil och den ouppfyllda flexibiliteten hos genetiska vacciner. … Eftersom vilket protein som helst kan uttryckas från mRNA utan att man behöver justera produktionsprocessen, erbjuder mRNA-vacciner också maximal flexibilitet med avseende på utveckling. Sammantaget presenterar mRNA en lovande vektor som mycket väl kan bli grunden för en ny teknikplattform för vaccin.

En annan recension, från 2013, betonar deras säkerhet:

Under de senaste åren har mRNA-vacciner dykt upp som ett säkert och potent tillvägagångssätt för induktion av cellulära immunsvar.

Liksom en nyare recension, från 2019:

Under de senaste två decennierna har det funnits ett brett intresse för RNA-baserade teknologier för utveckling av profylaktiska och terapeutiska vacciner. Prekliniska och kliniska prövningar har visat att mRNA-vaccin ger ett säkert och långvarigt immunsvar i djurmodeller och människor.

det finns massor av information som visar att de är säkra

anledningen till att de inte användes i stor utsträckning tidigare hade ingenting att göra med deras säkerhet

de är idealiskt lämpade som det första svaret på en pandemi som rör sig snabbt och inte lika väl lämpade som rutinmetoden för en vana långtidssituation

Tack för all bra information.

Jag har inte följt de tekniska detaljerna men från den vanliga nyhetsbevakningen fick jag idén att mRNA-vacciner som helhet är ganska nya.

Det var ett väldigt välformulerat svar! Försöker inte vara oförskämd eller så, men varför bryr sig folk om att skriva dessa omfattande svar för främlingar?

Hur stor är chansen att mRNA blir " trasigt" på vägen och skapar giftiga proteiner?

Hittade detta när jag letade och har mailat till mig själv för att jag har gett mina vaccin tveksamma vänner och familj. Tack för det här!

När cellerna i din kropp behöver ett nytt protein, gör de en kopia av genen från det proteinet. Genen finns i DNA:t och kopian är en molekyl av mRNA. Molekylära maskiner som kallas ribosomer kommer sedan att använda informationen i mRNA-molekylen för att sätta ihop det nya proteinet.

mRNA-vaccin förser cellerna med mRNA. Cellernas DNA förändras inte på något sätt. Istället kommer ribosomerna att läsa av mRNA:t som tillhandahålls av vaccinet och använda det för att sätta ihop det protein som mRNA:t bär instruktionerna för. När det gäller BioNTech/Pfizer-vaccinet är det aktuella mRNA:t mRNA för det så kallade spikeproteinet på ytan av SARS-CoV-2-viruset. Detta protein är ofarligt i sig, men när cellernas ribosomer sätter ihop det kommer de att känna igen det som ett främmande protein och kommer därför att ge ett immunsvar mot det.

Eftersom immunsystemet hos en vaccinerad person redan har stött på en del av viruset tidigare, har de en enorm fördel gentemot ovaccinerade personer om de skulle bli infekterade med viruset.

Inga mRNA-baserade vacciner är godkända för allmänt bruk ännu, så vi har mindre erfarenhet och studier på dem än andra typer av vacciner. Det betyder dock inte att vi är helt osäkra på hur säkra de är. Jag rekommenderar dig att ta en titt på wikipedia-artikeln om COVID-vacciner för att se hur många personer som är involverade i de kliniska prövningarna för varje vaccin.

Forskning om mRNA-vaccin började inte med covid-19-pandemin. BioNTech startade själva forskning om mRNA-vaccin mot influensa 2018. Bara för att inga mRNA-baserade vacciner är godkända för allmänt bruk betyder det inte att de är en helt ny teknologi. Det är något som vaccinforskare har undersökt i åratal, så vi vet mer om deras säkerhet än du tror.

Edit: Lade till några källor. Se /u/iayork's kommentar för ännu mer källor och information.


Ribosomsubenheter

Ribosomer i prokaryoter är av en 70S typ eller innehåller två underenheter. 30-S betecknar den mindre underenheten, och 50-S representerar den större underenheten. Ribosomala subenheter är stora nukleoproteinpartiklar som har båda nukleinsyra (RNA) och flera proteiner. I allmänhet är ribosomens molekylvikt nästan 2,7×106 Dalton.

16S rRNA och 21 proteiner utgör tillsammans bildandet av den mindre subenheten, dvs 30-S subenheten av ribosomen. Dessutom utgör 5S plus 23S rRNA och 31 proteiner den större subenheten, dvs 50S subenheten av ribosomen.

Båda underenheterna går sedan samman för att konfigurera en komplett 70-S ribosom vid tidpunkten för proteinsyntesen. 70-S-typen av ribosomer är 25nm bred, och dess antal per bakteriecell är ca 15,000 ribosomer.

Både 50-S och 30-S typ av subenheter har tre platser för association av tRNA:

  • A: Denna term betecknar aminoacylkedjan. Den accepterar det inkommande aminoacylerade tRNA:t.
  • P: Denna term betecknar peptidylkedjan. Det håller tRNA med den begynnande peptidkedjan.
  • E: Denna term representerar utgångsstället och håller det deacylerade tRNA:t.

Som vi vet är ribosomer tillverkningsenheter som säkerställer syntesen av protein. Både 30S och 50S underenheten spelar lika en grundläggande roll under översättning av mRNA till protein. 30S-subenheten spelar en viktig roll i associationen av antikodonstället för adapter-tRNA-molekylen till mRNA-strängen som transkriberas från DNA:t.

Den reglerar också basparning av mRNA-kodonerna och tRNA-antikodonerna under avkodningsprocessen. Därför står 30S-subenheten också för noggrannheten i basparningen under translation.

50S-subenheten spelar en betydande roll i bindningen av acceptorarm av tRNA. Sedan initierar tRNA:t polypeptidkedjebildningen i förhållande till informationen som tillhandahålls i mRNA:t. Den parar den inkommande aminosyran på A-ställets tRNA och den begynnande peptidkedjan fäst till P-ställets tRNA.

Ribosomens 3D-struktur avslöjar att det finns 1540 nukleotider av RNA och 21 polypeptidkedjor i den 30S ribosomala subenheten. I 50S-subenheten av prokaryota ribosomer finns det 2900 nukleotider av RNA och 31 polypeptidkedjor. Genom strukturen av ribosomen kan man analysera bindningsställena för tRNA, mRNA och lite antibiotika riktar sig mot ribosomerna.

Fungera

Den individuella rollen för 30S- och 50S-underenheterna förklaras nedan:

30S underenhet: Det tillhandahåller bindningsstället för det inkommande transkriberade mRNA:t. Den mindre subenheten av prokaryotisk ribosom säkerställer också specifik basparning mellan kodonen och antikodonerna på mRNA respektive tRNA.

50S underenhet: Den större subenheten av prokaryot medierar peptidbindningsbildningen under peptidylöverföringsreaktionen. Det fungerar också som hämningsställe för många antibiotika, inklusive makrolider, kloramfenikol, klindamycin och pleuromutilinerna.

Dessutom förhindrar det för tidig polypeptidhydrolys. Det fungerar också som en region, till vilken G-proteinfaktorer kan binda som reglerar initiering, förlängning och avslutning. Förutom detta hjälper 50S-subenheten också till proteinveckningen efter translationen. 50S-subenheten har ett peptidyltransferasaktivitetsställe som bildar peptidbindningen.

Betydelse

Ribosomerna är stora RNA-proteinkomplex, och det spelar en avgörande roll i studiet av RNA, proteiner och antibiotikainteraktion. Genom strukturen av ribosomen kan vi studera RNA struktur och dess interaktioner med proteiner. Många antibiotika interagerar med ribosomerna för att hämma translationsprocessen.

Därför kan rollen av antibiotika som riktar sig mot ribosomer också studeras av medicinska skäl. Den primära funktionen hos en ribosom är att underlätta bindningen av mRNA med tRNA under översättning eller proteinsyntes. Proteiner är grundläggande byggstenar i alla levande celler, så dess syntes är nödvändig.


Hur syntetiserar ribosomer proteiner?

Ribosomer fyller i huvudsak samma funktion i de flesta prokaryota och eukaryota organismer på jorden. Men ibland kan detaljerna variera lite från organism till organism. I allmänhet syntetiserar ribosomen dock proteiner från ett mRNA-transkript som producerades av cellen under transkription. När det gäller människor producerar vi mRNA i cellens kärna och skickar det till cytoplasman för translation.

Var ribosomen binder och hur den binder till mRNA skiljer sig också från organism till organism, men när den väl börjar läsa mRNA är processen nästan identisk. Ribosomen binder och kan läsa en serie av tre baser som kallas ett kodon. I naturen finns det 64 möjliga kodon som alla kodar för antingen en aminosyra eller "stopp". Ribosomen kommer att röra sig längs mRNA:t och läsa varje kodon och konstruera en kedja av aminosyror och fästa aminosyror till den växande änden för att bilda en proteinkedja.

Ribosomen kommer då att träffa ett stoppkodon som sedan talar om att proteinet är färdigt. Ribosomen släpper sedan taget om mRNA som bryts ned och släpper även proteinet så att det kan fylla sin funktion.


Referenser

Chu D, Kazana E, Bellanger N, Singh T, Tuite MF, von der Haar T. Translationsförlängning kan styra translationsinitiering på eukaryota mRNA. EMBO J. 201433:21–34.

Stein KC, Frydman J. Stop-and-go-trafiken som reglerar proteinbiogenes: hur translationskinetik styr proteostas. J Biol Chem. 2019294:2076–84.

Zhao TL, Zhang S, Qian WF. Cis-regulatoriska mekanismer och biologiska effekter av translationsförlängning. Yi Chuan. 202042:613–31.

Agashe D, Martinez-Gomez NC, Drummond DA, Marx CJ. Bra kodoner, dåligt transkript: stora minskningar i genuttryck och kondition till följd av synonyma mutationer i ett nyckelenzym. Mol Biol Evol. 201330:549–60.

Sharma AK, O'Brien EP. Icke-jämviktskoppling av proteinstruktur och funktion till translation-förlängningskinetik. Curr Opin Struct Biol. 201849:94–103.

Gershenson A, Gierasch LM. Proteinveckning i cellen: utmaningar och framsteg. Curr Opin Struct Biol. 201121:32–41.

Drummond DA, Wilke CO. Felöversättningsinducerad proteinfelveckning som en dominerande begränsning för kodningssekvensevolution. Cell. 2008134:341–52.

Richter JD, Coller J. Pausa på polyribosomer: ge plats för förlängning i translationell kontroll. Cell. 2015163:292–300.

Ikeuchi K, Tesina P, Matsuo Y, Sugiyama T, Cheng J, Saeki Y, Tanaka K, Becker T, Beckmann R, Inada T. Kolliderade ribosomer bildar ett unikt strukturellt gränssnitt för att inducera Hel2-drivna kvalitetskontrollvägar. EMBO J. 201938:e100276.

Juszkiewicz S, Hegde RS. Initiering av kvalitetskontroll under poly(A)-translation kräver platsspecifik ribosomubiquitination. Mol Cell. 201765:743–50 e744.

Sundaramoorthy E, Leonard M, Mak R, Liao J, Fulzele A, Bennett EJ. ZNF598 och RACK1 reglerar däggdjursribosomassocierad kvalitetskontrollfunktion genom att förmedla reglerad 40S ribosomal ubiquitylering. Mol Cell. 201765:751–60 e754.

Park H, Subramaniam AR. Inverterad translationell kontroll av eukaryot genuttryck genom ribosomkollisioner. PLoS Biol. 201917:e3000396.

Brandman O, Hegde RS. Ribosomassocierad proteinkvalitetskontroll. Nat Struct Mol Biol. 201623:7–15.

Joazeiro CAP. Mekanismer och funktioner för ribosomassocierad proteinkvalitetskontroll. Nat Rev Mol Cell Biol. 201920:368–83.

Matsuo Y, Tesina P, Nakajima S, Mizuno M, Endo A, Buschauer R, Cheng J, Shounai O, Ikeuchi K, Saeki Y, et al. RQT-komplex dissocierar ribosomer som kolliderade på endogent RQC-substrat SDD1. Nat Struct Mol Biol. 202027:323–32.

Juszkiewicz S, Chandrasekaran V, Lin Z, Kraatz S, Ramakrishnan V, Hegde RS. ZNF598 är en kvalitetskontrollsensor av kolliderade ribosomer. Mol Cell. 201872:469–81 e467.

Ingolia NT, Ghaemmaghami S, Newman JR, Weissman JS. Genomomfattande analys in vivo av translation med nukleotidupplösning med användning av ribosomprofilering. Vetenskap. 2009324:218–23.

Ingoliet NT. Ribosomprofilering: nya synpunkter på translation, från enstaka kodoner till genomskala. Nat Rev Genet. 201415:205–13.

Hussmann JA, Patchett S, Johnson A, Sawyer S, Press WH. Att förstå fördomar i ribosomprofileringsexperiment avslöjar signaturer för translationsdynamik i jäst. PLoS Genet. 201511:e1005732.

Weinberg DE, Shah P, Eichhorn SW, Hussmann JA, Plotkin JB, Bartel DP. Förbättrade ribosom-fotavtryck och mRNA-mätningar ger insikter i dynamik och reglering av jästöversättning. Cell Rep. 201614:1787–99.

Qian W, Yang JR, Pearson NM, Maclean C, Zhang J. Balanserad kodonanvändning optimerar eukaryot translationseffektivitet. Plos Genet. 20128:e1002603.

Charneski CA, Hurst LD. Positivt laddade rester är de viktigaste bestämningsfaktorerna för ribosomala hastighet. Plos Biol. 201311:e1001508.

Yang JR, Chen X, Zhang J. Kodon-för-kodon-modulering av translationshastighet och noggrannhet via mRNA-vikning. Plos Biol. 201412:e1001910.

Guydosh NR, Green R. Dom34 räddar ribosomer i 3′ oöversatta regioner. Cell. 2014156:950–62.

Ivanov IP, Shin BS, Loughran G, Tzani I, Young-Baird SK, Cao C, Atkins JF, Dever TE. Polyaminkontroll av translationsförlängning reglerar val av startställe på antizymhämmar-mRNA via ribosomkö. Mol Cell. 201870:254–64 e256.

Diament A, Feldman A, Schochet E, Kupiec M, Arava Y, Tuller T. Omfattningen av ribosomköer i spirande jäst. Plos Comput Biol. 201814:e1005951.

Wruck F, Katranidis A, Nierhaus KH, Buldt G, Hegner M. Översättning och veckning av enstaka proteiner i realtid. Proc Natl Acad Sci U S A. 2017114:E4399–407.

Hershberg R, Petrov DA. Selektion på kodonbias. Annu Rev Genet. 200842:287–99.

Nissley DA, O'Brien EP. Förändrad co-translationell bearbetning spelar en roll i Huntingtons patogenes - en hypotes. Främre Mol Neurosci. 20169:54.

Clarke TF, Clark PL. Sällsynta kodonkluster. Plos ett. 20083:e3412.

Chen S, Li K, Cao W, Wang J, Zhao T, Huan Q, Yang YF, Wu S, Qian W. Kodonupplösningsanalys avslöjar en direkt och kontextberoende påverkan av individuella synonyma mutationer på mRNA-nivå. Mol Biol Evol. 201734:2944–58.

Yu CH, Dang Y, Zhou Z, Wu C, Zhao F, Sachs MS, Liu Y. Kodonanvändning påverkar den lokala translationsförlängningshastigheten för att reglera kotranslationell proteinveckning. Mol Cell. 201559:744–54.

Arava Y, Wang Y, Storey JD, Liu CL, Brown PO, Herschlag D. Genomomfattande analys av mRNA-översättningsprofiler i Saccharomyces cerevisiae. Proc Natl Acad Sci U S A. 2003100:3889–94.

Klopotowski T, Wiater A. Synergism av aminotriazol och fosfat på hämning av jäst imidazol glycerol fosfat dehydratas. Arch Biochem Biophys. 1965112:562–6.

Patel BK, Gavin-Smyth J, Liebman SW. Jästens globala transkriptionella co-repressorprotein Cyc8 kan föröka sig som en prion. Nat Cell Biol. 200911:344–9.

Fang NN, Chan GT, Zhu M, Comyn SA, Persaud A, Deshaies RJ, Rotin D, Gsponer J, Mayor T. Rsp5/Nedd4 är det huvudsakliga ubiquitinligaset som riktar sig mot cytosoliska felveckade proteiner efter värmestress. Nat Cell Biol. 201416:1227–37.

Weinert BT, Scholz C, Wagner SA, Iesmantavicius V, Su D, Daniel JA, Choudhary C. Lysinsuccinylering är en ofta förekommande modifiering i prokaryoter och eukaryoter och överlappar i stor utsträckning acetylering. Cell Rep. 20134:842–51.

Han P, Shichino Y, Schneider-Poetsch T, Mito M, Hashimoto S, Udagawa T, Kohno K, Yoshida M, Mishima Y, Inada T, Iwasaki S. Genomomfattande undersökning av ribosomkollision. Cell Rep. 202031:107610.

Hedges SB, Dudley J, Kumar S. TimeTree: en offentlig kunskapsbas av divergenstider mellan organismer. Bioinformatik. 200622:2971–2.

Rodnina MV. Ribosomen i aktion: inställning av translationseffektivitet och proteinveckning. Protein Sci. 201625:1390–406.

Nelson DL, Lehninger AL, Cox MM. Lehningers principer för biokemi. 5:e uppl. New York: W.H. Freeman 2008.

Bryson JW, Betz SF, Lu HS, Suich DJ, Zhou HX, O'Neil KT, DeGrado WF. Proteindesign: ett hierarkiskt tillvägagångssätt. Vetenskap. 1995270:935–41.

Myers JK, Pace CN, Scholtz JM. Helixbenägenhet är identisk i proteiner och peptider. Biokemi. 199736:10923–9.

Chandrasekaran V, Juszkiewicz S, Choi J, Puglisi JD, Brown A, Shao S, Ramakrishnan V, Hegde RS. Mekanism för ribosomstopp under translation av en poly(A)-svans. Nat Struct Mol Biol. 201926:1132–40.

Sharp PM, Li WH. Kodonanpassningsindex - ett mått på riktad synonymt kodonanvändningsbias och dess potentiella tillämpningar. Nucleic Acids Res. 198715:1281–95.

Joazeiro CAP. Ribosomal stalling under translation: tillhandahåller substrat för ribosomassocierad proteinkvalitetskontroll. Annu Rev Cell Dev Biol. 201733:343–68.

Matsuo Y, Ikeuchi K, Saeki Y, Iwasaki S, Schmidt C, Udagawa T, Sato F, Tsuchiya H, Becker T, Tanaka K, et al. Ubiquitination av avstannade ribosomer utlöser ribosomassocierad kvalitetskontroll. Nat Commun. 20178:159.

Ikeuchi K, Izawa T, Inada T. Nyligen framsteg på den molekylära mekanismen för kvalitetskontroller som induceras av ribosomstopp. Främre Genet. 20189:743.

Doring K, Ahmed N, Riemer T, Suresh HG, Vainshtein Y, Habich M, Riemer J, Mayer MP, O'Brien EP, Kramer G, Bukau B. Profilering av Ssb-begynnande kedjeinteraktioner avslöjar principerna för Hsp70-assisterad vikning. Cell. 2017170:298–311 e220.

Fuchs RT, Sun Z, Zhuang F, Robb GB. Bias i ligationsbaserad liten RNA-sekvenseringsbibliotekskonstruktion bestäms av adapter och RNA-struktur. Plos ett. 201510:e0126049.

Lareau LF, Hite DH, Hogan GJ, Brown PO. Distinkta stadier av translationsförlängningscykeln avslöjas genom sekvensering av ribosomskyddade mRNA-fragment. Elife. 20143:e01257.

Mohammad F, Green R, Buskirk AR. En systematiskt reviderad ribosomprofileringsmetod för bakterier avslöjar pauser vid enkelkodonupplösning. Elife. 20198:e42591.

Wu CC, Zinshteyn B, Wehner KA, Green R. Högupplöst ribosomprofilering definierar diskreta ribosomförlängningstillstånd och translationell reglering under cellulär stress. Mol Cell. 201973:959–70 e955.

Mohammad F, Woolstenhulme CJ, Green R, Buskirk AR. Förtydligande av det translationella pauslandskapet i bakterier genom ribosomprofilering. Cell Rep. 201614:686–94.

McGlincy NJ, Ingolia NT. Transkriptomomfattande mätning av translation genom ribosomprofilering. Metoder. 2017126:112–29.

Meydan S, Guydosh NR. Disome- och trisomprofilering avslöjar genomomfattande mål för ribosomkvalitetskontroll. Mol Cell. 202079:588–602 e586.

Arpat AB, Liechti A, De Matos M, Dreos R, Janich P, Gatfield D. Transkriptomomfattande platser av kolliderade ribosomer avslöjar principer för translationell paus. Genome Res. 202030:985–99.

Prabhakar A, Capece MC, Petrov A, Choi J, Puglisi JD. Ribosommellanprodukt efter avslutad verkan fungerar som inkörsporten till ribosomåtervinning. Cell Rep. 201720:161–72.

Presnyak V, Alhusaini N, Chen YH, Martin S, Morris N, Kline N, Olson S, Weinberg D, Baker KE, Graveley BR, Coller J. Kodonoptimalitet är en viktig determinant för mRNA-stabilitet. Cell. 2015160:1111–24.

Aitken CE, Puglisi JD. Efter intersubunit-konformationen av ribosomen under translation i realtid. Nat Struct Mol Biol. 201017:793–800.

Pelechano V, Wei W, Steinmetz LM. Utbredd co-translationell RNA-sönderfall avslöjar ribosomdynamik. Cell. 2015161:1400–12.

Tuller T, Carmi A, Vestsigian K, Navon S, Dorfan Y, Zaborske J, Pan T, Dahan O, Furman I, Pilpel Y. En evolutionärt konserverad mekanism för att kontrollera effektiviteten av proteinöversättning. Cell. 2010141:344–54.

Schneider-Poetsch T, Ju J, Eyler DE, Dang Y, Bhat S, Merrick WC, Green R, Shen B, Liu JO. Hämning av eukaryotisk translationsförlängning av cykloheximid och laktimidomycin. Nat Chem Biol. 20106:209–17.

Archer SK, Shirokikh NE, Beilharz TH, Preiss T. Dynamik av ribosomskanning och återvinning avslöjas genom översättningskomplex profilering. Natur. 2016535:570–4.

Williams AJ, Paulson HL. Polyglutamin neurodegeneration: proteinfelveckning återupptas. Trender Neurosci. 200831:521–8.

Rauscher S, Baud S, Miao M, Keeley FW, Pomes R. Prolin och glycin kontrollerar proteins självorganisering till elastomera eller amyloidfibriller. Strukturera. 200614:1667–76.

Nilsson OB, Hedman R, Marino J, Wickles S, Bischoff L, Johansson M, Muller-Lucks A, Trovato F, Puglisi JD, O'Brien EP, et al. Cotranslationell proteinveckning inuti ribosomutgångstunneln. Cell Rep. 201512:1533–40.

Fedyukina DV, Cavagnero S. Proteinvikning vid utgångstunneln. Annu Rev Biophys. 201140:337–59.

Voss NR, Gerstein M, Steitz TA, Moore PB. Geometrin för den ribosomala polypeptidens utgångstunnel. J Mol Biol. 2006360:893–906.

Stein KC, Kriel A, Frydman J. Nascent polypeptiddomäntopologi och förlängningshastighet styr den cotranslationella hierarkin av Hsp70 och TRiC/CCT. Mol Cell. 201975:1117–30 e1115.

Chotewutmontri P, Barkan A. Dynamics of chloroplast translation under chloroplast differentiation in majs. Plos Genet. 201612:e1006106.

Bazzini AA, Lee MT, Giraldez AJ. Ribosomprofilering visar att miR-430 minskar translation innan det orsakar mRNA-sönderfall i zebrafisk. Vetenskap. 2012336:233–7.

Chen J, Brunner AD, Cogan JZ, Nunez JK, Fields AP, Adamson B, Itzhak DN, Li JY, Mann M, Leonetti MD, Weissman JS. Genomgripande funktionell översättning av icke-kanoniska mänskliga öppna läsramar. Vetenskap. 2020367:1140–6.

Martin M. Cutadapt tar bort adaptersekvenser från sekvensläsningar med hög genomströmning. EMBnet J. 201117:10–2.

Cherry JM, Hong EL, Amundsen C, Balakrishnan R, Binkley G, Chan ET, Christie KR, Costanzo MC, Dwight SS, Engel SR, et al. Saccharomyces Genome Database: genomikresursen för spirande jäst. Nucleic Acids Res. 201240:D700–5.

Langmead B, Trapnell C, Pop M, Salzberg SL. Ultrasnabb och minneseffektiv anpassning av korta DNA-sekvenser till det mänskliga genomet. Genome Biol. 200910:R25.

Kim D, Pertea G, Trapnell C, Pimentel H, Kelley R, Salzberg SL. TopHat2: exakt anpassning av transkriptomer i närvaro av insertioner, deletioner och genfusioner. Genome Biol. 201314:R36.

Lu J, Deutsch C. Vikningszoner inuti den ribosomala utgångstunneln. Nat Struct Mol Biol. 200512:1123–9.

Merritt GH, Naemi WR, Mugnier P, Webb HM, Tuite MF, von der Haar T. Avkodningsnoggrannhet i eRF1-mutanter och dess korrelation med pleiotropa kvantitativa egenskaper i jäst. Nucleic Acids Res. 201038:5479–92.

Mastronarde DN. Automatiserad elektronmikroskoptomografi med robust förutsägelse av provets rörelser. J Struct Biol. 2005152:36–51.

Zheng SQ, Palovcak E, Armache JP, Verba KA, Cheng Y, Agard DA. MotionCor2: anisotropisk korrigering av strålinducerad rörelse för förbättrad kryoelektronmikroskopi. Nat Methods. 201714:331–2.

Shaikh TR, Gao H, Baxter WT, Asturias FJ, Boisset N, Leith A, Frank J. SPIDER bildbehandling för enpartikelrekonstruktion av biologiska makromolekyler från elektronmikrofotografier. Nat Protoc. 20083:1941–74.

Zhang K. Gctf: bestämning och korrigering av CTF i realtid. J Struct Biol. 2016193:1–12.

Zivanov J, Nakane T, Forsberg BO, Kimanius D, Hagen WJ, Lindahl E, Scheres SH. Nya verktyg för automatiserad högupplöst cryo-EM-strukturbestämning i RELION-3. eLife. 20187:e42166.

Chen Y, Chen S, Li K, Zhang Y, Huang X, Li T, Wu S, Wang Y, Carey LB, Qian W. Överdosering av balanserade proteinkomplex minskar spridningshastigheten i aneuploida celler. Cell Syst. 20199:129–42 e125.

Cox J, Mann M. MaxQuant möjliggör höga peptididentifieringshastigheter, individualiserad massanoggrannhet i p.p.b.-intervallet och proteomomfattande proteinkvantifiering. Nat Biotechnol. 200826:1367–72.

Yates AD, Achuthan P, Akanni W, Allen J, Allen J, Alvarez-Jarreta J, Amode MR, Armean IM, Azov AG, Bennett R, et al. Ensembl 2020. Nucleic Acids Res. 202048:D682–8.

Dobin A, Davis CA, Schlesinger F, Drenkow J, Zaleski C, Jha S, Batut P, ​​Chaisson M, Gingeras TR. STAR: ultrasnabb universell RNA-seq aligner. Bioinformatik. 201329:15–21.

UniProt Consortium. UniProt: ett världsomspännande nav för proteinkunskap. Nucleic Acids Res. 201947:D506–15.

Garnier J, Gibrat JF, Robson B. GOR metod för att förutsäga protein sekundär struktur från aminosyrasekvens. Metoder Enzymol. 1996266:540–53.

Kinsella RJ, Kahari A, Haider S, Zamora J, Proctor G, Spudich G, Almeida-King J, Staines D, Derwent P, Kerhornou A, et al. Ensembl BioMarts: ett nav för datahämtning över taxonomiskt utrymme. Databas (Oxford). 20112011:bar030.

Resurssamordnare NCBI. Databasresurser från National Center for Biotechnology Information. Nucleic Acids Res. 201846:D8–D13.

Larkin MA, Blackshields G, Brown NP, Chenna R, McGettigan PA, McWilliam H, Valentin F, Wallace IM, Wilm A, Lopez R, et al. Clustal W and Clustal X version 2.0. Bioinformatik. 200723:2947–8.

Kumar S, Stecher G, Suleski M, Hedges SB. TimeTree: en resurs för tidslinjer, tidsträd och divergenstider. Mol Biol Evol. 201734:1812–9.

Lorenz R, Bernhart SH, Honer Zu Siederdissen C, Tafer H, Flamm C, Stadler PF, Hofacker IL. ViennaRNA Package 2.0. Algorithms Mol Biol. 20116:26.

Barrett T, Wilhite SE, Ledoux P, Evangelista C, Kim IF, Tomashevsky M, Marshall KA, Phillippy KH, Sherman PM, Holko M, et al. NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 201341:D991–5.

Zhao T, Chen Y-M, Li Y, Wang J, Chen S, Gao N, Qian W. Disome-seq data in yeast cells. Gene Expression Omnibus. 2020. https://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE158572. Accessed 10 Dec 2020.

Perez-Riverol Y, Csordas A, Bai J, Bernal-Llinares M, Hewapathirana S, Kundu DJ, Inuganti A, Griss J, Mayer G, Eisenacher M, et al. The PRIDE database and related tools and resources in 2019: improving support for quantification data. Nucleic Acids Res. 201947:D442–50.

Zhao T, Chen Y-M, Li Y, Wang J, Chen S, Gao N, Qian W. Disome-seq reveals sequence-mediated coupling of translational pauses and protein structures. ProteomeXchange Consortium. 2020. https://www.ebi.ac.uk/pride/archive/projects/PXD015271. Accessed 10 Dec 2020.

Lawson CL, Baker ML, Best C, Bi C, Dougherty M, Feng P, van Ginkel G, Devkota B, Lagerstedt I, Ludtke SJ, et al. EMDataBank.org: unified data resource for CryoEM. Nucleic Acids Res. 201139:D456–64.

Zhao T, Chen Y-M, Li Y, Wang J, Chen S, Gao N, Qian W. Cryo-EM structure of disome from saccharomyces cerevisiae, the leading ribosome in the rotated state with A/P and P/E tRNAs. Electron Microscopy Data Bank. 2020. https://www.ebi.ac.uk/pdbe/entry/emdb/EMD-30553. Accessed 23 Dec 2020.

Zhao T, Chen Y-M, Li Y, Wang J, Chen S, Gao N, Qian W. Cryo-EM structure of disome from saccharomyces cerevisiae, the trailing ribosome in the rotated state with A/P and P/E tRNAs. Electron Microscopy Data Bank. 2020. https://www.ebi.ac.uk/pdbe/entry/emdb/EMD-30554. Accessed 23 Dec 2020.

Zhao T, Chen Y-M, Li Y, Wang J, Chen S, Gao N, Qian W. Cryo-EM structure of disome from saccharomyces cerevisiae, the leading ribosome in the rotated state with A/P and P/E tRNAs (cycloheximide treatment). Electron Microscopy Data Bank. 2020. https://www.ebi.ac.uk/pdbe/entry/emdb/EMD-30580. Accessed 23 Dec 2020.

Zhao T, Chen Y-M, Li Y, Wang J, Chen S, Gao N, Qian W. Cryo-EM structure of disome from saccharomyces cerevisiae, the trailing ribosome in the rotated state with A/P and P/E tRNAs (cycloheximide treatment). Electron Microscopy Data Bank. 2020. https://www.ebi.ac.uk/pdbe/entry/emdb/EMD-30581. Accessed 23 Dec 2020.

Zhao T, Chen Y-M, Li Y, Wang J, Chen S, Gao N, Qian W. Disome-seq. Github. 2020. https://github.com/mingming-cgz/Disome-seq. Accessed 10 Dec 2020.

Zhao T, Chen Y-M, Li Y, Wang J, Chen S, Gao N, Qian W. Disome-seq. Zenodo. 2020. https://doi.org/10.5281/zenodo.4312535. Accessed 10 Dec 2020.


77 Ribosomes and Protein Synthesis

I slutet av det här avsnittet kommer du att kunna göra följande:

  • Beskriv de olika stegen i proteinsyntesen
  • Diskutera ribosomernas roll i proteinsyntesen

Syntesen av proteiner förbrukar mer av en cells energi än någon annan metabolisk process. I sin tur står proteiner för mer massa än någon annan komponent i levande organismer (med undantag för vatten), och proteiner utför praktiskt taget alla funktioner i en cell. Processen för translation, eller proteinsyntes, involverar avkodning av ett mRNA-meddelande till en polypeptidprodukt. Aminosyror träs kovalent ihop genom att sammanlänka peptidbindningar i längder som sträcker sig från cirka 50 till mer än 1000 aminosyrarester. Varje enskild aminosyra har en aminogrupp (NH2och en karboxylgrupp (COOH). Polypeptider bildas när aminogruppen i en aminosyra bildar en amidbindning (dvs peptid) med karboxylgruppen i en annan aminosyra ((Figur)). Denna reaktion katalyseras av ribosomer och genererar en vattenmolekyl.

The Protein Synthesis Machinery

Förutom mRNA-mallen bidrar många molekyler och makromolekyler till translationsprocessen. Sammansättningen av varje komponent kan variera mellan arter, till exempel kan ribosomer bestå av olika antal rRNA och polypeptider beroende på organismen. However, the general structures and functions of the protein synthesis machinery are comparable from bacteria to human cells. Translation kräver inmatning av en mRNA-mall, ribosomer, tRNA och olika enzymatiska faktorer. (Obs: En ribosom kan ses som ett enzym vars aminosyrabindningsställen specificeras av mRNA.)

Click through the steps of this PBS interactive to see protein synthesis in action.

Ribosomer

Redan innan ett mRNA översätts måste en cell investera energi för att bygga var och en av sina ribosomer. I E coli, det finns mellan 10 000 och 70 000 ribosomer närvarande i varje cell vid varje given tidpunkt. A ribosome is a complex macromolecule composed of structural and catalytic rRNAs, and many distinct polypeptides. In eukaryotes, the nucleolus is completely specialized for the synthesis and assembly of rRNAs.

Ribosomer finns i cytoplasman hos prokaryoter och i cytoplasman och det grova endoplasmatiska retikulum hos eukaryoter. Mitokondrier och kloroplaster har också sina egna ribosomer i matrisen och stroma, som ser mer ut som prokaryota ribosomer (och har liknande läkemedelskänslighet) än ribosomerna strax utanför deras yttre membran i cytoplasman. Ribosomer dissocierar till stora och små subenheter när de inte syntetiserar proteiner och återassocieras under initieringen av translation. I E. coli beskrivs den lilla subenheten som 30S, och den stora subenheten är 50S, totalt 70S (kom ihåg att Svedberg-enheter inte är additiv). Däggdjursribosomer har en liten 40S subenhet och en stor 60S subenhet, totalt 80S. Den lilla subenheten är ansvarig för att binda mRNA-mallen, medan den stora subenheten sekventiellt binder tRNA. Varje mRNA-molekyl översätts samtidigt av många ribosomer, alla syntetiserar protein i samma riktning: läser mRNA från 5′ till 3′ och syntetiserar polypeptiden från N-terminalen till C-terminalen. Den kompletta mRNA/poly-ribosomstrukturen kallas en polysom.

TRNA

tRNA är strukturella RNA-molekyler som transkriberades från gener av RNA-polymeras III. Beroende på art finns 40 till 60 typer av tRNA i cytoplasman. Transfer-RNA fungerar som adaptermolekyler. Varje tRNA bär en specifik aminosyra och känner igen ett eller flera av de mRNA-kodon som definierar ordningen på aminosyrorna i ett protein. Aminoacyl-tRNA binder till ribosomen och lägger till motsvarande aminosyra till polypeptidkedjan. Därför är tRNA de molekyler som faktiskt "översätter" RNA-språket till proteinernas språk.

Av de 64 möjliga mRNA-kodonen – eller triplettkombinationer av A, U, G och C – specificerar tre avslutningen av proteinsyntesen och 61 specificerar tillägget av aminosyror till polypeptidkedjan. Av dessa 61 kodar ett kodon (AUG) också för initieringen av translation. Varje tRNA-antikodon kan baspar med ett eller flera av mRNA-kodonen för sin aminosyra. Till exempel, om sekvensen CUA inträffade på en mRNA-mall i den rätta läsramen, skulle den binda ett leucin-tRNA som uttrycker den komplementära sekvensen, GAU. Förmågan hos vissa tRNA att matcha mer än ett kodon är det som ger den genetiska koden dess blockiga struktur.

Som adaptermolekyler för translation är det förvånande att tRNA kan passa så mycket specificitet i ett så litet paket. Tänk på att tRNA behöver interagera med tre faktorer: 1) de måste kännas igen av rätt aminoacylsyntetas (se nedan) 2) de måste kännas igen av ribosomer och 3) de måste binda till rätt sekvens i mRNA.

Aminoacyl tRNA-syntetaser

Processen med pre-tRNA-syntes genom RNA-polymeras III skapar endast RNA-delen av adaptermolekylen. Motsvarande aminosyra måste tillsättas senare, när tRNA har bearbetats och exporterats till cytoplasman. Genom processen att tRNA "laddning" är varje tRNA-molekyl kopplad till sin korrekta aminosyra av en av en grupp enzymer som kallas aminoacyl-tRNA-syntetaser. Minst en typ av aminoacyl-tRNA-syntetas finns för var och en av de 20 aminosyrorna, det exakta antalet aminoacyl-tRNA-syntetaser varierar beroende på art. Dessa enzymer binder och hydrolyserar först ATP för att katalysera en högenergibindning mellan en aminosyra och adenosinmonofosfat (AMP), en pyrofosfatmolekyl stöts ut i denna reaktion. Den aktiverade aminosyran överförs sedan till tRNA:t och AMP frisätts. Termen “laddning” är lämplig, eftersom den högenergibindning som binder en aminosyra till dess tRNA senare används för att driva bildandet av peptidbindningen. Varje tRNA har fått sitt namn efter sin aminosyra.

Mekanismen för proteinsyntes

Liksom med mRNA-syntes kan proteinsyntes delas in i tre faser: initiering, förlängning och avslutning. Översättningsprocessen liknar prokaryoter och eukaryoter. Här ska vi utforska hur översättning sker i E coli, en representativ prokaryot, och specificera eventuella skillnader mellan prokaryot och eukaryot translation.

Initiering av översättning

Proteinsyntes börjar med bildandet av ett initieringskomplex. I E coli, involverar detta komplex den lilla 30S-ribosomen, mRNA-mallen, tre initieringsfaktorer (IFs IF-1, IF-2 och IF-3) och en speciell initiator-tRNA, kallad tRNA Metf.

I E coli mRNA, en sekvens uppströms om det första AUG-kodonet, kallad Shine-Dalgarno-sekvensen (AGGAGG), interagerar med rRNA-molekylerna som utgör ribosomen. Denna interaktion förankrar den 30S ribosomala subenheten på rätt plats på mRNA-mallen. Guanosintrifosfat (GTP), som är ett purinnukleotidtrifosfat, fungerar som en energikälla under translation - både i början av förlängningen och under ribosomens translokation. Bindning av mRNA till 30S-ribosomen kräver också IF-III.

Initiator-tRNA:t interagerar sedan med startkodonet AUG (eller sällan GUG). Detta tRNA bär på aminosyran metionin, som formyleras efter att det fästs vid tRNA:t. Formyleringen skapar en “faux” peptidbindning mellan formylkarboxylgruppen och aminogruppen i metioninet. Bindning av fMet-tRNA Metf medieras av initieringsfaktorn IF-2. fMet börjar varje polypeptidkedja som syntetiseras av E coli, men det tas vanligtvis bort efter att översättningen är klar. När en AUG i läsramen påträffas under translationsförlängning, infogas en icke-formylerad metionin av en vanlig Met-tRNA Met. Efter bildandet av initieringskomplexet förenas den 30S ribosomala subenheten av 50S subenheten för att bilda translationskomplexet. I eukaryoter bildas ett liknande initieringskomplex, innefattande mRNA, den 40S lilla ribosomala subenheten, eukaryota IFs och nukleosidtrifosfater (GTP och ATP). Metioninet på det laddade initiator-tRNA, kallat Met-tRNAi, är inte formylerad. Men Met-tRNAi skiljer sig från andra Met-tRNA genom att det kan binda IF.

Istället för att deponeras vid Shine-Dalgarno-sekvensen, känner det eukaryota initieringskomplexet igen 7-metylguanosinkapseln vid 5′-änden av mRNA. Ett cap-bindande protein (CBP) och flera andra IFs hjälper till att förflytta ribosomen till 5′ cap. Väl vid locket spårar initieringskomplexet längs mRNA:t i riktningen 5′ till 3′, och söker efter AUG-startkodonet. Många eukaryota mRNA översätts från den första augusti, men detta är inte alltid fallet. Enligt Kozaks regler indikerar nukleotiderna runt AUG om det är rätt startkodon. Kozaks regler säger att följande konsensussekvens måste visas runt AUG för ryggradsdjursgener: 5′-gccRccAUGG-3′. R (för purin) indikerar ett ställe som kan vara antingen A eller G, men som inte kan vara C eller U. I huvudsak, ju närmare sekvensen är denna konsensus, desto högre blir translationseffektiviteten.

När lämplig AUG har identifierats, dissocierar de andra proteinerna och CBP, och 60S-subenheten binder till komplexet av Met-tRNAimRNA och 40S-subenheten. Detta steg fullbordar initieringen av translation i eukaryoter.

Översättning, förlängning och uppsägning

I prokaryoter och eukaryoter är grunderna för förlängning desamma, så vi kommer att se över förlängning ur perspektivet E coli. När translationskomplexet bildas består den tRNA-bindande regionen av ribosomen av tre fack. A (aminoacyl)-stället binder inkommande laddade aminoacyl-tRNA. P (peptidyl)-stället binder laddade tRNA som bär aminosyror som har bildat peptidbindningar med den växande polypeptidkedjan men som ännu inte har dissocierats från deras motsvarande tRNA. E (exit)-stället frisätter dissocierade tRNA så att de kan laddas med fria aminosyror. Det initierande metionyl-tRNA:t upptar emellertid P-stället i början av translationsförlängningsfasen i både prokaryoter och eukaryoter.

Under translationsförlängning tillhandahåller mRNA-mallen tRNA-bindningsspecificitet. När ribosomen rör sig längs mRNA:t kommer varje mRNA-kodon i register, och specifik bindning med motsvarande laddade tRNA-antikodon säkerställs. Om mRNA inte var närvarande i förlängningskomplexet skulle ribosomen binda tRNA ospecifikt och slumpmässigt (?).

Förlängning fortsätter med laddade tRNA:n som sekventiellt kommer in i och lämnar ribosomen när varje ny aminosyra läggs till polypeptidkedjan. Förflyttning av ett tRNA från A till P till E-ställe induceras av konformationsförändringar som för fram ribosomen med tre baser i 3′-riktningen. Energin för varje steg längs ribosomen doneras av förlängningsfaktorer som hydrolyserar GTP. GTP-energi krävs både för bindningen av ett nytt aminoacyl-tRNA till A-stället och för dess translokation till P-stället efter bildandet av peptidbindningen. Peptidbindningar bildas mellan aminogruppen i aminosyran bunden till A-ställets tRNA och karboxylgruppen i aminosyran bunden till P-ställets tRNA. Bildandet av varje peptidbindning katalyseras av peptidyltransferas, ett RNA-baserat enzym som är integrerat i 50S ribosomala subenheten. Energin för varje peptidbindningsbildning härrör från den högenergibindning som länkar varje aminosyra till dess tRNA. Efter peptidbindningsbildning, flyttar A-ställets tRNA som nu håller den växande peptidkedjan till P-stället, och P-ställets tRNA som nu är tomt flyttas till E-stället och drivs ut från ribosomen ((Figur)). Otroligt nog E coli translationsapparaten tar bara 0,05 sekunder att lägga till varje aminosyra, vilket innebär att ett protein med 200 aminosyror kan översättas på bara 10 sekunder.

Många antibiotika hämmar bakteriell proteinsyntes. Till exempel blockerar tetracyklin A-stället på den bakteriella ribosomen och kloramfenikol blockerar peptidylöverföring. Vilken specifik effekt skulle du förvänta dig att var och en av dessa antibiotika skulle ha på proteinsyntesen?

Tetracyklin skulle direkt påverka:

Kloramfenikol skulle direkt påverka:

Avbrytande av translation sker när ett nonsenskodon (UAA, UAG eller UGA) påträffas. Vid anpassning till A-stället känns dessa nonsenskodon igen av proteinfrisättningsfaktorer som liknar tRNA. De frisättande faktorerna i både prokaryoter och eukaryoter instruerar peptidyltransferas att lägga till en vattenmolekyl till karboxyländen av P-ställets aminosyra. Denna reaktion tvingar P-ställets aminosyra att lossna från sitt tRNA, och det nytillverkade proteinet frisätts. De små och stora ribosomala subenheterna dissocierar från mRNA:t och från varandra rekryteras de nästan omedelbart till ett annat translationsinitieringskomplex. Efter att många ribosomer har slutfört translationen bryts mRNA så att nukleotiderna kan återanvändas i en annan transkriptionsreaktion.

Proteinvikning, modifiering och inriktning

Under och efter translation kan individuella aminosyror modifieras kemiskt, signalsekvenser läggas till och det nya proteinet "vikas" till en distinkt tredimensionell struktur som ett resultat av intramolekylära interaktioner. En signalsekvens är en kort sekvens vid aminoänden av ett protein som leder det till ett specifikt cellulärt fack. Dessa sekvenser kan ses som proteinets "tågbiljett" till dess slutliga destination och känns igen av signaligenkänningsproteiner som fungerar som ledare. Till exempel kommer en specifik signalsekvensterminal att styra ett protein till mitokondrierna eller kloroplasterna (i växter). När proteinet når sin cellulära destination klipps signalsekvensen vanligtvis av.

Många proteiner viker sig spontant, men vissa proteiner kräver hjälpmolekyler, så kallade ledsagare, för att förhindra att de aggregeras under den komplicerade processen att vika. Även om ett protein är korrekt specificerat av dess motsvarande mRNA, kan det anta en helt dysfunktionell form om onormala temperatur- eller pH-förhållanden hindrar det från att vikas korrekt.

Sektionssammanfattning

Spelarna i translation inkluderar mRNA-mallen, ribosomer, tRNA och olika enzymatiska faktorer. Den lilla ribosomala subenheten binder till mRNA-mallen antingen vid Shine-Dalgarno-sekvensen (prokaryoter) eller 5′ cap (eukaryoter). Translation börjar vid den initierande AUG på mRNA, specificerar metionin. Bildandet av peptidbindningar sker mellan sekventiella aminosyror som matchas till mRNA-mallen av deras tRNA enligt den genetiska koden. Laddade tRNA:n går in i det ribosomala A-stället och deras aminosyra binder till aminosyran på P-stället. Hela mRNA:t översätts i "steg" med tre nukleotider i ribosomen. När ett nonsenskodon påträffas binder en frisättningsfaktor och dissocierar komponenterna och frigör det nya proteinet. Vikning av proteinet sker under och efter translation.

Frågor om visuell anslutning

(Figur) Många antibiotika hämmar bakteriell proteinsyntes. Till exempel blockerar tetracyklin A-stället på den bakteriella ribosomen och kloramfenikol blockerar peptidylöverföring. Vilken specifik effekt skulle du förvänta dig att var och en av dessa antibiotika skulle ha på proteinsyntesen?

Tetracyklin skulle direkt påverka:

Kloramfenikol skulle direkt påverka

(Figur) Tetracyklin: en Kloramfenikol: c.

Granska frågor

The RNA components of ribosomes are synthesized in the ________.

In any given species, there are at least how many types of aminoacyl tRNA synthetases?

A scientist introduces a mutation that makes the 60S ribosomal subunit nonfunctional in a human cell line. What would be the predicted effect on translation?

  1. Translation stalls after the initiation AUG codon is identified.
  2. The ribosome cannot catalyze the formation of peptide bonds between the tRNAs in the A and P sites.
  3. The ribosome cannot interact with mRNAs.
  4. tRNAs cannot exit the E site of the ribosome.

Frågor om kritiskt tänkande

Transkribera och översätt följande DNA-sekvens (icke-mallsträng): 5′-ATGGCCGGTTATTAAGCA-3′

mRNA:t skulle vara: 5′-AUGGCCGGUUAUUAAGCA-3′. Proteinet skulle vara: MAGY. Även om det finns sex kodon, motsvarar det femte kodonet ett stopp, så det sjätte kodonet skulle inte översättas.

Förklara hur enstaka nukleotidförändringar kan ha väldigt olika effekter på proteinfunktionen.

Nukleotidförändringar i kodonens tredje position kanske inte ändrar aminosyran och skulle inte ha någon effekt på proteinet. Andra nukleotidförändringar som ändrar viktiga aminosyror eller skapar eller tar bort start- eller stoppkodon skulle ha allvarliga effekter på proteinets aminosyrasekvens.

Ett normalt mRNA som läser 5’ – UGCCAUGGUAAUAACACAUGAGGCCUGAAC– 3’ har en insättningsmutation som ändrar sekvensen till 5’ -UGCCAUGGUUAAUAACACAUGAGGCCUGAAC– 3’. Översätt det ursprungliga mRNA:t och det muterade mRNA:t och förklara hur insättningsmutationer kan ha dramatiska effekter på proteiner. (Tips: Se till att hitta startplatsen.)

Ursprungligt mRNA: 5' -UGCC AUG GUA AUA ACA CAU GAG GCC UGA AC- 3'

Översättning: Met – Val – Ile – Thr – His – Glu – Ala

Muterat mRNA: 5'-UGCC AUG GUU AAU AAC ACA UGA GGCCUGAAC– 3'

Översättning: Met – Val – Asn – Asn – Thr

Insättningsmutationer kan ha dramatiska effekter på proteiner eftersom de förskjuter läsramen för kodonen. Detta ändrar aminosyrorna som kodas av mRNA:t och kan introducera för tidigt start- eller stoppställen.

Ordlista


Titta på videon: mRNA Translation Advanced (Augusti 2022).